PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy016026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 404aa    MW: 43931.6 Da    PI: 6.0122
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59553011PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.3e-33139197159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+++++k+v++tYeg+Hnhe
  Ahy016026 139 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERASHNTKYVITTYEGKHNHE 197
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-36124199IPR003657WRKY domain
SuperFamilySSF1182906.67E-29132199IPR003657WRKY domain
PROSITE profilePS5081137.734134199IPR003657WRKY domain
SMARTSM007743.3E-38139198IPR003657WRKY domain
PfamPF031061.1E-25140197IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGEAGENYAK LEGSGWKNVQ PGAKDTKHSL DWKADGQERT SSTSVVTELS DPMSTNKGKP  60
LCAFEAEDTP EHSSTLASND GDEDGTTQAL APAEDDAEDD ESDSKRRKKE NYLVESTLPS  120
RAVREPRVVV QIETEIDILD DGYRWRKYGQ KVVKGNPNPR SYYKCTSAGC PVRKHVERAS  180
HNTKYVITTY EGKHNHEVPT ARTNNHVSSN DGGLPPSGPN GQSALALPGS AVIPKSENHQ  240
TLTSHFDRKP EFGSDFLRPS LVGAFSNNLK FGSSPMCQMK YPSLSSTMPY GSFGLNPDRC  300
TAPQAGSIPS VYPDFPMPLP LNLPSSGNFS LAGLNFNCAK PMNPVQPFLS GQQVKDIDTG  360
FLRPKQEQKD DAIYGTCLPP VDHGNSSSAA PSSIYQQVMQ NFPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-33130199877Probable WRKY transcription factor 4
2lex_A3e-33130199877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016194006.10.0PREDICTED: WRKY transcription factor SUSIBA2-like
TrEMBLV7B1N40.0V7B1N4_PHAVU; Uncharacterized protein
STRINGGLYMA18G47741.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.17e-47WRKY DNA-binding protein 2